PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_03442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25835.6 Da    PI: 8.056
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_03442genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.96.3e-291059251
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                rien + rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gklye++s
  PEQU_03442 10 RIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFAS 59
                8***********************************************86 PP

2K-box72.99.4e-2579170697
       K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                 +++ +e++ ++++q+++ + k+i+ L+ ++R+l+Ge+Les+s++eL++Le++Le+s++k+R +Kn+ll eq+ +l++kek l een  L+k+
  PEQU_03442  79 NNKSNEQNIQQWKQDSELMSKKIDVLEDSKRKLMGENLESCSVEELHELETELEQSISKVRWRKNHLLEEQVVQLKEKEKVLLEENALLQKQ 170
                 5668999********************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.5E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.314161IPR002100Transcription factor, MADS-box
CDDcd002655.55E-42370No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-32384IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2483170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.35587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MVRGRTEMRR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIVFSP RGKLYEFASS  60
SMLKTIERYK MNNKEVIDNN KSNEQNIQQW KQDSELMSKK IDVLEDSKRK LMGENLESCS  120
VEELHELETE LEQSISKVRW RKNHLLEEQV VQLKEKEKVL LEENALLQKQ GPHTTLSLWK  180
EPLQGLNTSK EMVPQCDKNM DVETELYVGW PGGGGRTQQL LKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-17369268Myocyte-specific enhancer factor 2A
3p57_I1e-17369268Myocyte-specific enhancer factor 2A
3p57_D1e-17369268Myocyte-specific enhancer factor 2A
3p57_C1e-17369268Myocyte-specific enhancer factor 2A
3p57_B1e-17369268Myocyte-specific enhancer factor 2A
3p57_A1e-17369268Myocyte-specific enhancer factor 2A
3kov_J1e-17369268Myocyte-specific enhancer factor 2A
3kov_I1e-17369268Myocyte-specific enhancer factor 2A
3kov_B1e-17369268Myocyte-specific enhancer factor 2A
3kov_A1e-17369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8528380.0KT852838.1 Phalaenopsis hybrid cultivar suppressor of overexpression of CO1 (SOC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919081.11e-83PREDICTED: MADS-box transcription factor 50-like isoform X2
RefseqXP_010934008.11e-83PREDICTED: MADS-box transcription factor 50-like isoform X3
RefseqXP_010934007.11e-83PREDICTED: MADS-box transcription factor 50-like isoform X3
RefseqXP_010934006.11e-83PREDICTED: MADS-box transcription factor 50-like isoform X3
RefseqXP_010934005.11e-83PREDICTED: MADS-box transcription factor 50-like isoform X3
SwissprotQ9XJ605e-80MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A142CKN81e-159A0A142CKN8_9ASPA; Suppressor of overexpression of CO1
STRINGOB10G24040.14e-79(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.12e-54AGAMOUS-like 19